NINGBO INNO PHARMCHEM CO.,LTD. is pleased to present its high-quality offering of LL-37 Peptide powder (CAS 154947-66-7). This peptide represents a significant natural defense mechanism within the human body, acting as a potent endogenous antimicrobial agent and multifaceted immunomodulator. Sourced and processed to ensure exceptional purity, this raw material is an invaluable component for cutting-edge research and pharmaceutical development.
LL-37 is the sole human cathelicidin antimicrobial peptide, derived from the processing of the hCAP-18 protein. Its structure, an amphiphilic alpha helical polypeptide composed of 37 amino acids (sequence: LLGDFFRKSKEKIGKEFKRIVQRKDFLRNLVPRTES), allows it to interact effectively with microbial membranes. With a molecular weight of approximately 4493.3 g/mol, LL-37 is a relatively small, yet biologically powerful, molecule.
The primary function of LL-37 lies in its broad-spectrum antimicrobial activity. It exhibits efficacy against a wide range of bacteria, including gram-positive and gram-negative strains, fungi, and some viruses. Crucially, it has demonstrated significant potential against multidrug-resistant (MDR) pathogens, addressing a critical global health challenge. Its mechanism often involves disrupting microbial cell membranes, leading to rapid cell death, a mode of action distinct from many conventional antibiotics, which can help circumvent existing resistance mechanisms.
Beyond direct antimicrobial effects, LL-37 is a key player in modulating the host immune response. It can influence both innate and adaptive immunity, recruiting immune cells to sites of infection or injury, promoting phagocytosis, and modulating cytokine production. This immunomodulatory capacity means LL-37 doesn't just kill pathogens; it also helps to orchestrate the body's own defense and repair processes. This dual function makes it particularly interesting for complex conditions where infection and inflammation are intertwined.
One of the most compelling applications for LL-37 as a raw material is in the field of wound healing. It promotes epithelial cell migration and proliferation, stimulates angiogenesis (the formation of new blood vessels), and modulates the inflammatory environment within the wound bed. These actions accelerate tissue regeneration and the closure of wounds, including chronic or difficult-to-heal types often complicated by infection, such as MRSA-infected chronic wounds mentioned in research. The ability to offer a high-purity peptide powder allows formulators to develop topical gels or other delivery systems specifically tailored for wound care applications.
Furthermore, LL-37's immunomodulatory properties are being investigated for their role in inflammatory and autoimmune conditions. While its deficiency has been linked to increased susceptibility to certain infections and impaired wound healing, its overexpression has been implicated in driving inflammation in diseases like psoriasis. Research exploring targeted inhibition or supplementation strategies based on LL-37 levels highlights its complex and vital role in maintaining immune homeostasis. Studies in animal models, for instance, have shown that exogenous LL-37 supplementation can reduce intestinal inflammation in inflammatory bowel disease (IBD), suggesting potential therapeutic avenues.
The challenge of drug resistance continues to grow, making the discovery and development of new antibacterial agents essential. LL-37, as an endogenous peptide with a unique mechanism of action and activity against MDR strains and biofilms (like those formed by Pseudomonas aeruginosa), offers a promising avenue. Its ability to penetrate biofilms, protective structures that shield bacteria from antibiotics and the host immune system, is particularly noteworthy for treating persistent infections.

As a raw material, the quality and purity of LL-37 peptide powder are paramount for ensuring reliable and reproducible results in research and safe, effective products in development. NINGBO INNO PHARMCHEM CO.,LTD. provides LL-37 powder with a purity typically exceeding 99%, verified by rigorous analytical methods such as HPLC. Supplying this material in a stable powder form is crucial for storage, transportation, and subsequent formulation into various dosage forms for preclinical or clinical studies.
The attributes of LL-37 – its broad-spectrum activity, efficacy against drug-resistant pathogens and biofilms, potent wound healing promotion, and intelligent immune regulation – underscore its potential as a foundational component for novel therapies. Its role connecting innate immunity and tissue repair makes it a central molecule of interest in infectious diseases, dermatology, and immunology.
For researchers and pharmaceutical companies looking to explore the therapeutic potential of this remarkable peptide, securing a reliable source of high-purity raw material is the first step. NINGBO INNO PHARMCHEM CO.,LTD. stands as a trusted manufacturer and supplier of LL-37 peptide powder, committed to quality and consistency. We understand the critical need for material that meets stringent specifications for analytical research, *in vitro* and *in vivo* studies, and potential scale-up for clinical trials.
Prospective partners interested in integrating high-quality LL-37 peptide into their research or product pipeline can make an inquiry regarding the price and availability. NINGBO INNO PHARMCHEM CO.,LTD. facilitates the process to buy or purchase this advanced raw material, supporting advancements in combating drug resistance, improving wound care, and developing novel immunomodulatory treatments. Contact us today to learn more about how our LL-37 peptide powder can contribute to your scientific and development goals.
Manufacturing Facilities






Professional Export Experience
to Global Customers
1. 20 years of R&D, manufacturing and sales experience, serving customers in 60 countries and regions around the world;
2. Own R&D laboratory, pilot platform and large-scale production workshop, which can meet the audit requirements of global customers;
3. We can satisfy customers' perfect transition from small scale lab requirements (gram level) to commercialization requirements (hundred tons level).
A: We don't have Minimum Order Quantity, exact quantity should be provided before quotation for us to calculate the exact cost.
A: We don't provide free samples due to lots of request and expensive international courier's cost, we can deduct the sample charge after commercial order placed.
A: Our payment terms: Small or sample order: T/T IN ADVANCE. Commercial order: First order should be by T/T IN ADVANCE or L/C at sight, and following orders T/T 30~90days is acceptable subject to approval of credit application.