Custom Manufacturing, Project Outsourcing, your Trusted Partner from China
For researchers engaged in critical studies of immunology, infectious diseases, wound healing, and cancer, the quality and reliability of the reagents used are paramount. Among the essential biomolecules, LL-37 peptide has emerged as a compound of significant interest due to its diverse biological activities. This guide provides researchers with key considerations for sourcing high-quality LL-37 peptide, ensuring the integrity and success of their experiments.
LL-37 is a human cathelicidin antimicrobial peptide, characterized by its 37 amino acid sequence ([LL-37, 37 aa]). Its CAS number is 154947-66-7. As a vital component of the innate immune system, LL-37 exhibits broad-spectrum antimicrobial activity and significant immunomodulatory functions. When procuring this peptide, researchers must prioritize purity, as even minor impurities can affect experimental outcomes and lead to misleading results.
The standard for purity for research-grade peptides like LL-37 is typically ≥95%, often verified by High-Performance Liquid Chromatography (HPLC). Reputable suppliers will provide a Certificate of Analysis (CoA) detailing the purity, identity, and other critical specifications of the peptide batch. It is also advisable to look for suppliers who conduct rigorous quality control measures and provide detailed technical data, including solubility and storage recommendations. Understanding these specifications is crucial before you buy LL-37 peptide.
When selecting a supplier, consider their expertise in peptide synthesis and their reputation within the scientific community. Factors such as consistent product quality, reliable delivery, and responsive customer support are vital. Manufacturers specializing in the synthesis of complex peptides are more likely to offer a product that meets the stringent demands of cutting-edge research. As a leading supplier, we understand these needs and ensure our LL-37 peptide is manufactured to the highest standards.
The price of LL-37 peptide can vary depending on the quantity, purity, and supplier. While cost is a factor, it should not be the sole determinant. Investing in high-purity peptide from a trusted source is essential for the validity of your research. We offer LL-37 peptide with guaranteed high purity, backed by comprehensive quality control. For those seeking to buy LL-37 peptide, partnering with a knowledgeable and reliable manufacturer is key to achieving groundbreaking scientific results.
Manufacturing Facilities
Professional Export Experience
to Global Customers
1. 20 years of R&D, manufacturing and sales experience, serving customers in 60 countries and regions around the world;
2. Own R&D laboratory, pilot platform and large-scale production workshop, which can meet the audit requirements of global customers;
3. We can satisfy customers' perfect transition from small scale lab requirements (gram level) to commercialization requirements (hundred tons level).
A: We don't have Minimum Order Quantity, exact quantity should be provided before quotation for us to calculate the exact cost.
A: We don't provide free samples due to lots of request and expensive international courier's cost, we can deduct the sample charge after commercial order placed.
A: Our payment terms: Small or sample order: T/T IN ADVANCE. Commercial order: First order should be by T/T IN ADVANCE or L/C at sight, and following orders T/T 30~90days is acceptable subject to approval of credit application.
